PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT08095
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 283aa    MW: 31525.8 Da    PI: 10.3184
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT08095genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.41.9e-55291591128
       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk....kg 97 
               lppGfrFhPtdeel+++yL+ k+++  +++ ++i+evd++k+ePwdLp+k+k +ekewyfFs rd+ky+tg r+nrat++gyWk+tgkdke+++     ++
  EMT08095  29 LPPGFRFHPTDEELITYYLRGKIADAGFTA-RAITEVDLNKCEPWDLPEKAKMGEKEWYFFSLRDRKYPTGVRTNRATNAGYWKTTGKDKEIFTGqppsTQ 128
               79*************************999.89***************99999****************************************98888888 PP

       NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
               elvg+kktLvfykgrap+gek++Wvmheyrl
  EMT08095 129 ELVGMKKTLVFYKGRAPRGEKSNWVMHEYRL 159
               88***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.79E-6425180IPR003441NAC domain
PROSITE profilePS5100560.14329180IPR003441NAC domain
PfamPF023656.5E-2930159IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MEGSGGGGGG GGAAVSKKKS SKEGEEESLP PGFRFHPTDE ELITYYLRGK IADAGFTARA  60
ITEVDLNKCE PWDLPEKAKM GEKEWYFFSL RDRKYPTGVR TNRATNAGYW KTTGKDKEIF  120
TGQPPSTQEL VGMKKTLVFY KGRAPRGEKS NWVMHEYRLH LKPASKSNKD EWVVCRIFAK  180
SPGVKKYPSS TNAHSRSHHH PYTLDMVPQF LPTLLGHDLF GGGRGHHHPY MTPADLAELS  240
RFARGTPGLH PHIQPHPAAA GSPRCRCRWA GSSSRRAVPM ARR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-552818616171NO APICAL MERISTEM PROTEIN
1ut4_B3e-552818616171NO APICAL MERISTEM PROTEIN
1ut7_A3e-552818616171NO APICAL MERISTEM PROTEIN
1ut7_B3e-552818616171NO APICAL MERISTEM PROTEIN
4dul_A3e-552818616171NAC domain-containing protein 19
4dul_B3e-552818616171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00277DAPTransfer from AT2G24430Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010238320.11e-152PREDICTED: NAC domain-containing protein 92-like
SwissprotQ9FLJ21e-80NC100_ARATH; NAC domain-containing protein 100
SwissprotQ9FLR37e-81NAC79_ARATH; NAC domain-containing protein 79
TrEMBLM8B3950.0M8B395_AEGTA; Uncharacterized protein
STRINGMLOC_68185.21e-153(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP93613846
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.24e-88NAC domain containing protein 38